PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0116s0037.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 236aa    MW: 27297.9 Da    PI: 6.2317
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0116s0037.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.61.7e-1617106198
                          EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                          ffkv      ++++r+ +p +f+ ++  g  +++    l  ++g++W+v+l   + +++ ++t+GW+ Fvk+n ++ gDf+ Fkl+ +  
  Kalax.0116s0037.1.p  17 FFKVY--IADHSLNRMKVPSEFV-DYmRGR-TCG-AAELAGLNGETWQVEL--AQEGKHLFFTDGWQTFVKENMVEHGDFLFFKLHCNLM 99 
                          67777..455667889*******.662544.565.89**************..999999*************************987544 PP

                          E..EEEEE- CS
                   B3  90 felvvkvfr 98 
                          f   v +f+
  Kalax.0116s0037.1.p 100 F--SVVIFD 106
                          4..666665 PP

2B349.38.6e-161362181399
                          TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                           +  ++p  f+ e +  + + ++++l++ +  sW+v+l    ++ +y l +GW  Fv++n++kegD++ F+l++  + e++v++ r+
  Kalax.0116s0037.1.p 136 GAKPYIPTWFIGEDSVHHDRLQKMVLRTDEDSSWSVNL--HHSQHKYRLYGGWAVFVRDNNIKEGDTCKFELVN--RLEMKVHIMRR 218
                          55567888888777555667789***************..888888*************************976..77789999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-2011110IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-2011110IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.99915108IPR003340B3 DNA binding domain
CDDcd100171.54E-1515106No hitNo description
SMARTSM010191.5E-1017108IPR003340B3 DNA binding domain
PfamPF023621.8E-1417106IPR003340B3 DNA binding domain
PROSITE profilePS5086312.421124219IPR003340B3 DNA binding domain
CDDcd100172.52E-12127215No hitNo description
SMARTSM010196.0E-5128219IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-18134219IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-17139219IPR015300DNA-binding pseudobarrel domain
PfamPF023621.5E-13140218IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MRIDVEEEAD TDNLPEFFKV YIADHSLNRM KVPSEFVDYM RGRTCGAAEL AGLNGETWQV  60
ELAQEGKHLF FTDGWQTFVK ENMVEHGDFL FFKLHCNLMF SVVIFDETMC EKGVTLGAKS  120
SRGRDGVLEA EKVQNGAKPY IPTWFIGEDS VHHDRLQKMV LRTDEDSSWS VNLHHSQHKY  180
RLYGGWAVFV RDNNIKEGDT CKFELVNRLE MKVHIMRRSK TPSLHSPVKN HDLISE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.13e-15B3 family protein